PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sobic.001G102300.1.p
Common NameSb01g009130, SORBIDRAFT_01g009130
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Sorghinae; Sorghum
Family TALE
Protein Properties Length: 771aa    MW: 80774.4 Da    PI: 7.0469
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sobic.001G102300.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox28.42.7e-095736101954
                           HHH..SSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHH CS
              Homeobox  19 Fek..nrypsaeereeLAkklgLterqVkvWFqNrRak 54 
                           Fe   ++yps +++  LA+++gL+ +qV++WF N R +
  Sobic.001G102300.1.p 573 FEHflHPYPSDADKHLLARQTGLSRNQVSNWFINARVR 610
                           564459******************************88 PP

2BELL119.91.1e-38434504272
                  BELL   2 rqelqkkkakLlslleeVdkrYkqyveqlqtvissFeavaglgsakpYtslAlkaiSrhFrcLkdaiaeqi 72 
                           r e+q+kkakL+s+l+eVd+rY++y++q+q+v++ F+ v+g g+a+pYt+lA+ka+SrhFrcLkdaia q+
  Sobic.001G102300.1.p 434 RFEHQRKKAKLISMLDEVDRRYNHYCDQMQMVVNFFDSVMGFGAATPYTALAQKAMSRHFRCLKDAIAAQL 504
                           779*****************************************************************996 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM005741.9E-70356502IPR006563POX domain
PfamPF075261.1E-53361501IPR006563POX domain
PROSITE profilePS5007112.6551614IPR001356Homeobox domain
CDDcd000864.40E-13554615No hitNo description
SMARTSM003891.6E-9554618IPR001356Homeobox domain
SuperFamilySSF466892.65E-17556621IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.601.3E-28557620IPR009057Homeodomain-like
PfamPF059203.9E-18571610IPR008422Homeobox KN domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009965Biological Processleaf morphogenesis
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 771 aa     Download sequence    Send to blast
MGIAAPPYQQ TITTYVSQPT KSSAAISASA RAATATSMSH SQGFHHQASS GVYGYSSDGF  60
DRPDSSHHQQ DHHQQQHEHV AQQSRRDKLR VQAGFDPAAA AGHGLLPIDG GDDHGGPGSI  120
YEQAAAAAGA SNMLSEMFNF PAPPSGPSAT ELLASQMSAN YRFGLRQQQQ AGPGGVAGLS  180
GGDGGWFGTG AAGRAGLVLG GASMGSLGET SSPKQQQAGS MAGLATDPAA AMQLFLMNPQ  240
QQQQQSRSSP TSPPPSDVQH HEAFQAFGAA AGAAFGGAGT GVVEGQGLSL SLSPSLQQLE  300
MAKQAEELRV RDGVLYFNRQ QQQQGPTSVQ QQQLPMALHG QVGALGQQLH VGYGPAGVAG  360
VLRNSKYTRA AQELLEEFCS VGRGQIKGGA RGGRGASASN PNASNKQGGA SSSGAAQSPS  420
SASKEPPQLS PADRFEHQRK KAKLISMLDE VDRRYNHYCD QMQMVVNFFD SVMGFGAATP  480
YTALAQKAMS RHFRCLKDAI AAQLRTTCEL LGEKDAGTSS GLTKGETPRL RAIDQSLRQQ  540
RAFHHMGMME QEAWRPQRGL PERSVNILRS WLFEHFLHPY PSDADKHLLA RQTGLSRNQV  600
SNWFINARVR LWKPMIEEMY QQECRELEGS SAGGGGGPES GNDPSGADDS HSPTTTGAAQ  660
LPQQQQQHGT MPGVMMPHKP DPSAAGPSAA DAAFVGIDPV ELLGGDAHVG GGADDLYGRF  720
EPGVRVRYGP AAAGAAAGDV SLTLGLQHAG AGNAGPDSTG RFSLRDYSGC *
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4xrs_A2e-17560617158Homeobox protein Meis1
4xrs_B2e-17560617158Homeobox protein Meis1
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Sbi.161770.0panicle
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankEU9575010.0EU957501.1 Zea mays clone 1595427 homeodomain protein JUBEL1 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002466514.10.0hypothetical protein SORBIDRAFT_01g009130
SwissprotQ94KL51e-141BLH4_ARATH; BEL1-like homeodomain protein 4
TrEMBLC5WLY00.0C5WLY0_SORBI; Putative uncharacterized protein Sb01g009130
STRINGSb01g009130.10.0(Sorghum bicolor)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP44332945
Representative plantOGRP13316172
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G23760.31e-127BEL1-like homeodomain 4